Teriparatide 10mg – 10 vials

Teriparatide (also known as recombinant human parathyroid hormone 1-34 or rhPTH(1-34)) is a synthetic polypeptide research compound consisting of the biologically active N-terminal 34 amino acids of endogenous human parathyroid hormone (PTH), with the sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF. It functions as a potent osteoanabolic agent that binds to and activates parathyroid hormone type 1 receptors (PTH1R) on osteoblasts and osteoblast precursors. In preclinical models, intermittent (e.g., once-daily) administration preferentially stimulates osteoblastic activity over osteoclastic resorption, leading to increased bone formation on trabecular and cortical surfaces (both remodeling- and modeling-based), enhanced bone mineral density, improved trabecular microarchitecture, elevated markers of bone formation (e.g., bone-specific alkaline phosphatase, procollagen I carboxy-terminal propeptide), and greater bone strength. This contrasts with continuous PTH exposure (as in hyperparathyroidism), which favors net bone resorption. Teriparatide also modulates calcium and phosphate homeostasis by promoting renal calcium reabsorption, phosphate excretion, and indirect intestinal calcium absorption.
In research settings, teriparatide is utilized to investigate mechanisms of anabolic bone remodeling, PTH receptor signaling pathways (e.g., cAMP/PKA, Wnt/β-catenin modulation), differential effects of intermittent vs. continuous exposure on osteoblast/osteoclast coupling, therapeutic strategies for osteoporosis (including postmenopausal, male hypogonadal, glucocorticoid-induced, and high-fracture-risk models), fracture healing acceleration, bone quality enhancement beyond density (e.g., microarchitecture, cortical thickness), combination or sequential regimens with antiresorptives (e.g., denosumab, bisphosphonates), and broader roles of PTH analogs in skeletal homeostasis, regenerative medicine, and metabolic bone disorders. Its short half-life and subcutaneous delivery in research formulations support studies on dosing regimens for maximal anabolic window and minimal resorption activation.